🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PSMB7

DescrizioneProteasome subunit beta type-7

Gene and Protein Information

Gene ID5695
Uniprot Accession IDs Q99436 B4E0P1 Q5TBG6 Q96AG8 Q9BWA7
Ensembl ID ENSP00000259457
Symbol Z Z
FamilyBelongs to the peptidase T1B family.
Sequence
MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp464723PSMB7proteasome subunit beta 79598VGNC:4834OMA, EggNOG
Mouse19177Psmb7proteasome (prosome, macropain) subunit, beta type 710090MGI:107637Inparanoid, OMA, EggNOG
Rat85492Psmb7proteasome subunit beta 710116RGD:621093Inparanoid, OMA, EggNOG
Dog100686423PSMB7proteasome subunit beta 79615Inparanoid, OMA, EggNOG
Horse100067317PSMB7proteasome subunit beta 79796VGNC:21946Inparanoid, OMA, EggNOG
Cow511207PSMB7proteasome subunit beta 79913VGNC:33451Inparanoid, OMA, EggNOG
Pig100037992PSMB7proteasome subunit beta 79823Inparanoid, OMA, EggNOG
Opossum100015558PSMB7proteasome subunit beta 713616Inparanoid, EggNOG
Chicken378915PSMB7proteasome subunit beta 79031CGNC:49143OMA, EggNOG
Xenopus100486586psmb7proteasome (prosome, macropain) subunit, beta type, 78364XB-GENE-946042Inparanoid, OMA, EggNOG
Zebrafish64278psmb7proteasome subunit beta 77955ZDB-GENE-001208-4Inparanoid, OMA
C. elegans173168pbs-2Proteasome subunit beta type6239OMA, EggNOG
Fruitfly39628Prosbeta2Proteasome beta2 subunit7227FBgn0023174Inparanoid, EggNOG
S.cerevisiae854328PUP1proteasome core particle subunit beta 24932S000005683OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.