PSMB10

DescrizioneProteasome subunit beta type-10

Gene and Protein Information

Gene ID5699
Uniprot Accession IDs P40306 B2R5J4 Q5U098
Ensembl ID ENSP00000351314
Symbol LMP10 MECL1 LMP10 MECL1 beta2i
FamilyBelongs to the peptidase T1B family.
Sequence
MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp743176PSMB10proteasome subunit beta 109598VGNC:13783OMA, EggNOG
Mouse19171Psmb10proteasome (prosome, macropain) subunit, beta type 1010090MGI:1096380Inparanoid, OMA, EggNOG
Rat291983Psmb10proteasome subunit beta 1010116RGD:1307428Inparanoid, OMA, EggNOG
Dog489749PSMB10proteasome subunit beta 109615Inparanoid, OMA, EggNOG
Horse100066381PSMB10proteasome subunit beta 109796Inparanoid, OMA, EggNOG
Cow282328PSMB10proteasome subunit beta 109913Inparanoid, OMA, EggNOG
Opossum100021740PSMB10proteasome subunit beta 1013616Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.