🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PSMA6

DescrizioneProteasome subunit alpha type-6

Gene and Protein Information

Gene ID5687
Uniprot Accession IDs P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60
Ensembl ID ENSP00000261479
Symbol PROS27 IOTA p27K PROS27
FamilyBelongs to the peptidase T1A family.
Sequence
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp452861PSMA6proteasome subunit alpha 69598VGNC:3336Inparanoid, OMA, EggNOG
Macaque695113PSMA6proteasome subunit alpha 69544Inparanoid, OMA
Mouse26443Psma6proteasome (prosome, macropain) subunit, alpha type 610090MGI:1347006Inparanoid, OMA, EggNOG
Rat29673Psma6proteasome subunit alpha 610116RGD:61849Inparanoid, OMA, EggNOG
Dog480290PSMA6proteasome subunit alpha 69615VGNC:45091Inparanoid, OMA, EggNOG
Horse100050805PSMA6proteasome subunit alpha 69796VGNC:21936Inparanoid, OMA, EggNOG
Cow507213PSMA6proteasome subunit alpha 69913VGNC:33441Inparanoid, OMA, EggNOG
Pig100156790PSMA6proteasome subunit alpha 69823Inparanoid, OMA, EggNOG
Opossum100011101PSMA6proteasome subunit alpha 613616Inparanoid, EggNOG
Platypus100077605PSMA6proteasome subunit alpha 69258Inparanoid, OMA, EggNOG
Chicken423326PSMA6proteasome subunit alpha 69031CGNC:7649Inparanoid, OMA, EggNOG
Anole lizard100552112psma6proteasome subunit alpha 628377Inparanoid, OMA, EggNOG
Xenopus394718psma6proteasome subunit alpha 68364XB-GENE-943786Inparanoid, OMA, EggNOG
Zebrafish171585psma6aproteasome subunit alpha 6a7955ZDB-GENE-020326-1Inparanoid, OMA, EggNOG
C. elegans179941pas-1Proteasome subunit alpha type-66239Inparanoid, OMA
S.cerevisiae852873SCL1proteasome core particle subunit alpha 14932S000002979Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.