🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PTPN1

DescrizioneTyrosine-protein phosphatase non-receptor type 1

Gene and Protein Information

Gene ID5770
Uniprot Accession IDs P18031 Q5TGD8 Q9BQV9 Q9NQQ4
Ensembl ID ENSP00000360683
Symbol PTP1B PTP1B
FamilyBelongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.
Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp469970PTPN1protein tyrosine phosphatase, non-receptor type 19598VGNC:9943OMA, EggNOG
Macaque702016PTPN1protein tyrosine phosphatase, non-receptor type 19544Inparanoid, OMA, EggNOG
Mouse19246Ptpn1protein tyrosine phosphatase, non-receptor type 110090MGI:97805Inparanoid, OMA, EggNOG
Rat24697Ptpn1protein tyrosine phosphatase, non-receptor type 110116RGD:61965Inparanoid, OMA, EggNOG
Dog477263PTPN1protein tyrosine phosphatase, non-receptor type 19615VGNC:45167Inparanoid, OMA
Horse100052066PTPN1protein tyrosine phosphatase, non-receptor type 19796VGNC:22010Inparanoid, OMA
Cow508658PTPN1protein tyrosine phosphatase, non-receptor type 19913VGNC:33529Inparanoid, OMA
Pig396667PTPN1protein tyrosine phosphatase, non-receptor type 19823Inparanoid, OMA
Chicken395688PTPN1protein tyrosine phosphatase, non-receptor type 19031CGNC:6062Inparanoid, OMA
Anole lizardPTPN1protein tyrosine phosphatase, non-receptor type 1 [Source:HGNC Symbol;Acc:HGNC:9642]28377Inparanoid, OMA
Xenopus549875ptpn1protein tyrosine phosphatase, non-receptor type 18364XB-GENE-950442Inparanoid, OMA
Zebrafish30081ptpn1protein tyrosine phosphatase, non-receptor type 17955ZDB-GENE-980605-23Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.