🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TUBB1

DescrizioneTubulin beta-1 chain

Gene and Protein Information

Gene ID81027
Uniprot Accession IDs Q9H4B7
Ensembl ID ENSP00000217133
FamilyBelongs to the tubulin family.
Sequence
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp736308TUBB1tubulin beta 1 class VI9598VGNC:10060OMA, EggNOG
Macaque693889TUBB1tubulin beta 1 class VI9544Inparanoid, OMA, EggNOG
Mouse545486Tubb1tubulin, beta 1 class VI10090MGI:107814Inparanoid, OMA, EggNOG
Rat679312Tubb1tubulin, beta 1 class VI10116RGD:1589557OMA, EggNOG
Dog485950TUBB1tubulin beta 1 class VI9615VGNC:49697Inparanoid, OMA, EggNOG
Horse100056684TUBB1tubulin beta 1 class VI9796VGNC:24657Inparanoid, OMA, EggNOG
Cow541271TUBB1tubulin beta 1 class VI9913VGNC:36506Inparanoid, OMA, EggNOG
Pig100134983TUBB1tubulin beta 1 class VI9823Inparanoid, OMA, EggNOG
Opossum100027039TUBB1tubulin beta 1 class VI13616Inparanoid, EggNOG
PlatypusTUBB1tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257]9258OMA, EggNOG
Chicken396427TUBB1tubulin beta 1 class VI9031CGNC:49797OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    tubulin    /    Tubulin beta-1 chain
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Tubulin    /    Tubulin beta-1 chain

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.