ENHO

DescrizioneAdropin

Gene and Protein Information

Gene ID375704
Uniprot Accession IDs Q6UWT2 Q8N666
Ensembl ID ENSP00000382675
Symbol C9orf165 UNQ470 C9orf165
Sequence
MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse69638Enhoenergy homeostasis associated10090MGI:1916888Inparanoid, OMA, EggNOG
Horse100054090ENHOenergy homeostasis associated9796VGNC:17580Inparanoid, OMA, EggNOG
Cow783487ENHOenergy homeostasis associated9913VGNC:28494Inparanoid, OMA, EggNOG
Pig100303726ENHOenergy homeostasis associated9823Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.