🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

SGK1

DescrizioneSerine/threonine-protein kinase Sgk1

Gene and Protein Information

Gene ID6446
Uniprot Accession IDs O00141 B7UUP7 B7UUP8 B7UUP9 B7Z5B2 E1P583 Q5TCN2 Q5TCN3 Q5TCN4 Q5VY65 Q9UN56
Ensembl ID ENSP00000356832
Symbol SGK SGK
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Sequence
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp463011SGK1serum/glucocorticoid regulated kinase 19598VGNC:11250OMA, EggNOG
Macaque713082SGK1serum/glucocorticoid regulated kinase 19544Inparanoid, OMA, EggNOG
Mouse20393Sgk1serum/glucocorticoid regulated kinase 110090MGI:1340062Inparanoid, OMA, EggNOG
Rat29517Sgk1serum/glucocorticoid regulated kinase 110116RGD:3668Inparanoid, OMA, EggNOG
Dog403647SGK1serum/glucocorticoid regulated kinase 19615VGNC:46097Inparanoid, OMA, EggNOG
HorseSGK1serum/glucocorticoid regulated kinase 1 [Source:HGNC Symbol;Acc:HGNC:10810]9796OMA, EggNOG
Cow515854SGK1serum/glucocorticoid regulated kinase 19913VGNC:34541Inparanoid, OMA, EggNOG
Pig100625739SGK1serum/glucocorticoid regulated kinase 19823Inparanoid, OMA, EggNOG
Opossum100025435SGK1serum/glucocorticoid regulated kinase 113616OMA, EggNOG
Platypus100073891SGK1serum/glucocorticoid regulated kinase 19258Inparanoid, OMA, EggNOG
Chicken395133SGK1serum/glucocorticoid regulated kinase 19031CGNC:49184Inparanoid, OMA, EggNOG
Anole lizard100565714sgk1serum/glucocorticoid regulated kinase 128377Inparanoid, OMA, EggNOG
Xenopus594981sgk1serum/glucocorticoid regulated kinase 18364XB-GENE-1003518Inparanoid, OMA, EggNOG
Zebrafish324140sgk1serum/glucocorticoid regulated kinase 17955ZDB-GENE-030131-2860Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    non-receptor serine/threonine protein kinase    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    transfer/carrier protein    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    protein kinase    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    calmodulin    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    transferase    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    annexin    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    kinase    /    Serine/threonine-protein kinase sgk1
DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    SGK family    /    Serine/threonine-protein kinase sgk1

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.