RUVBL2

DescrizioneRuvB-like 2

Gene and Protein Information

Gene ID10856
Uniprot Accession IDs Q9Y230 B3KQ59 E7ETE5 Q6FIB9 Q6PK27 Q9Y361
Ensembl ID ENSP00000473172
Symbol INO80J TIP48 TIP49B RVB2 TIH2 ECP51 TIP48 CGI-46 ECP-51 INO80J REPTIN TIP49B TAP54-beta
FamilyBelongs to the RuvB family.
Sequence
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp468949RUVBL2RuvB like AAA ATPase 29598VGNC:8324OMA, EggNOG
Macaque100428794RUVBL2RuvB like AAA ATPase 29544Inparanoid, OMA, EggNOG
Mouse20174Ruvbl2RuvB-like protein 210090MGI:1342299Inparanoid, OMA
Rat292907Ruvbl2RuvB-like AAA ATPase 210116RGD:1306509Inparanoid, OMA, EggNOG
Dog476418RUVBL2RuvB like AAA ATPase 29615VGNC:45812Inparanoid, OMA, EggNOG
Horse100051665RUVBL2RuvB like AAA ATPase 29796VGNC:22633Inparanoid, OMA, EggNOG
Cow511048RUVBL2RuvB like AAA ATPase 29913VGNC:34224Inparanoid, OMA, EggNOG
Pig100511637RUVBL2RuvB like AAA ATPase 29823Inparanoid, OMA, EggNOG
Opossum100030444RUVBL2RuvB like AAA ATPase 213616Inparanoid, OMA, EggNOG
Anole lizard100558613ruvbl2RuvB like AAA ATPase 228377Inparanoid, OMA, EggNOG
Xenopus448144ruvbl2RuvB like AAA ATPase 28364XB-GENE-483344Inparanoid, OMA, EggNOG
Zebrafish317678ruvbl2RuvB-like AAA ATPase 27955ZDB-GENE-030109-1Inparanoid, OMA, EggNOG
C. elegans177458ruvb-2RuvB-like 26239Inparanoid, OMA, EggNOG
Fruitfly40092reptreptin7227FBgn0040075Inparanoid, EggNOG
S.cerevisiae855841RVB2RuvB family ATP-dependent DNA helicase reptin4932S000006156Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.