🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

RNLS

DescrizioneRenalase

Gene and Protein Information

Gene ID55328
Uniprot Accession IDs Q5VYX0 Q9BS33 Q9NUP8
Ensembl ID ENSP00000332530
Symbol C10orf59 C10orf59 RENALASE
FamilyBelongs to the renalase family.
Sequence
MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp450581RNLSrenalase, FAD dependent amine oxidase9598VGNC:12459OMA, EggNOG
MacaqueRNLSrenalase, FAD dependent amine oxidase [Source:HGNC Symbol;Acc:HGNC:25641]9544Inparanoid, OMA, EggNOG
Mouse67795Rnlsrenalase, FAD-dependent amine oxidase10090MGI:1915045Inparanoid, OMA, EggNOG
Rat361751Rnlsrenalase, FAD-dependent amine oxidase10116RGD:1309804Inparanoid, OMA, EggNOG
Dog610448RNLSrenalase, FAD dependent amine oxidase9615VGNC:45681Inparanoid, OMA, EggNOG
Horse100062318RNLSrenalase, FAD dependent amine oxidase9796VGNC:22490Inparanoid, OMA, EggNOG
Opossum100012984RNLSrenalase, FAD dependent amine oxidase13616Inparanoid, EggNOG
Anole lizard100555221rnlsrenalase, FAD dependent amine oxidase28377Inparanoid, OMA, EggNOG
Xenopus100037883rnlsrenalase, FAD-dependent amine oxidase8364XB-GENE-5831223Inparanoid, OMA, EggNOG
Zebrafish436880rnlsrenalase, FAD-dependent amine oxidase7955ZDB-GENE-040718-351Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.