🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MRPL54

Descrizione39S ribosomal protein L54, mitochondrial

Gene and Protein Information

Gene ID116541
Uniprot Accession IDs Q6P161 L54mt
Ensembl ID ENSP00000331849
Symbol L54mt MRP-L54
Sequence
MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp736047MRPL54mitochondrial ribosomal protein L549598VGNC:2311OMA, EggNOG
Mouse66047Mrpl54mitochondrial ribosomal protein L5410090MGI:1913297Inparanoid, OMA, EggNOG
Rat299628Mrpl54mitochondrial ribosomal protein L5410116RGD:1305694Inparanoid, OMA, EggNOG
Dog485052MRPL54mitochondrial ribosomal protein L549615VGNC:43406Inparanoid, OMA, EggNOG
Cow511926MRPL54mitochondrial ribosomal protein L549913VGNC:31649Inparanoid, OMA, EggNOG
Pig100521888MRPL54mitochondrial ribosomal protein L549823OMA, EggNOG
Opossum100021805MRPL54mitochondrial ribosomal protein L5413616Inparanoid, OMA, EggNOG
Platypus100080575MRPL54mitochondrial ribosomal protein L549258Inparanoid, EggNOG
Anole lizard100563699mrpl54mitochondrial ribosomal protein L5428377OMA, EggNOG
XenopusMRPL54mitochondrial ribosomal protein L54 [Source:HGNC Symbol;Acc:HGNC:16685]8364OMA, EggNOG
Zebrafish100034614mrpl54mitochondrial ribosomal protein L547955ZDB-GENE-050208-381Inparanoid, OMA, EggNOG
C. elegans172741mrpl-54Mitochondrial Ribosomal Protein, Large6239Inparanoid, EggNOG
Fruitfly37389mRpL54mitochondrial ribosomal protein L547227FBgn0034579Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.