🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

STEAP1

DescrizioneMetalloreductase STEAP1

Gene and Protein Information

Gene ID26872
Uniprot Accession IDs Q9UHE8 A4D1E0 O95034
Ensembl ID ENSP00000297205
Symbol PRSS24 STEAP STEAP PRSS24
FamilyBelongs to the STEAP family.
Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp463951STEAP1STEAP family member 19598VGNC:14465OMA, EggNOG
Macaque704448STEAP1STEAP family member 19544Inparanoid, OMA, EggNOG
Mouse70358Steap1six transmembrane epithelial antigen of the prostate 110090MGI:1917608Inparanoid, OMA, EggNOG
Rat297738Steap1STEAP family member 110116RGD:1311543Inparanoid, OMA, EggNOG
Dog475222STEAP1STEAP family member 19615Inparanoid, OMA, EggNOG
Horse100060223STEAP1STEAP family member 19796OMA, EggNOG
Cow515156STEAP1STEAP family member 19913OMA, EggNOG
Pig397573STEAP1STEAP family member 19823Inparanoid, OMA, EggNOG
Opossum100021193STEAP1STEAP family member 113616OMA, EggNOG
Chicken420540STEAP1STEAP family member 19031CGNC:51279OMA, EggNOG
Anole lizard100564454steap1STEAP family member 128377OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.