🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

SSTR5

DescrizioneSomatostatin receptor type 5

Gene and Protein Information

Gene ID6755
Uniprot Accession IDs P35346 P34988 Q541E0 Q9UJI5 SS-5-R
Ensembl ID ENSP00000293897
Symbol SS-5-R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse20609Sstr5somatostatin receptor 510090MGI:894282Inparanoid, OMA, EggNOG
Rat25354Sstr5somatostatin receptor 510116RGD:3765Inparanoid, OMA, EggNOG
Dog403454SSTR5somatostatin receptor 59615VGNC:46846Inparanoid, OMA, EggNOG
Horse100067398SSTR5somatostatin receptor 59796VGNC:23623Inparanoid, OMA, EggNOG
Cow510344SSTR5somatostatin receptor 59913VGNC:35328Inparanoid, OMA, EggNOG
Opossum100616853SSTR5somatostatin receptor 513616Inparanoid, OMA, EggNOG
PlatypusSSTR5somatostatin receptor 5 [Source:HGNC Symbol;Acc:HGNC:11334]9258OMA, EggNOG
Chicken427667SSTR5somatostatin receptor 59031CGNC:53162Inparanoid, OMA
Anole lizard100567150sstr5somatostatin receptor 528377Inparanoid, OMA
Xenopus100486456sstr5somatostatin receptor 58364XB-GENE-949452Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Somatostatin receptor type 5
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Somatostatin receptor type 5

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.