Toggle Nav 
Cerca
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | SPARC |
|---|
Gene and Protein Information
| Gene ID | 6678 |
|---|---|
| Uniprot Accession IDs | P09486 D3DQH9 Q6IBK4 |
| Ensembl ID | ENSP00000231061 |
| Symbol | ON ON OI17 BM-40 |
| Family | Belongs to the SPARC family. |
| Sequence | MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Mostra altro |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 471709 | SPARC | secreted protein acidic and cysteine rich | 9598 | VGNC:7154 | OMA, EggNOG |
| Macaque | 712388 | SPARC | secreted protein acidic and cysteine rich | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20692 | Sparc | secreted acidic cysteine rich glycoprotein | 10090 | MGI:98373 | Inparanoid, OMA, EggNOG |
| Rat | 24791 | Sparc | secreted protein acidic and cysteine rich | 10116 | RGD:3742 | Inparanoid, OMA, EggNOG |
| Dog | 100855736 | SPARC | secreted protein acidic and cysteine rich | 9615 | VGNC:46701 | Inparanoid, OMA, EggNOG |
| Horse | 100060119 | SPARC | secreted protein acidic and cysteine rich | 9796 | VGNC:23478 | Inparanoid, OMA, EggNOG |
| Cow | 282077 | SPARC | secreted protein acidic and cysteine rich | 9913 | VGNC:35171 | Inparanoid, OMA, EggNOG |
| Opossum | 100024756 | SPARC | secreted protein acidic and cysteine rich | 13616 | Inparanoid, EggNOG | |
| Platypus | 100075328 | SPARC | secreted protein acidic and cysteine rich | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 386571 | SPARC | secreted protein acidic and cysteine rich | 9031 | CGNC:3072 | Inparanoid, OMA |
| Anole lizard | 100554604 | sparc | secreted protein acidic and cysteine rich | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394973 | sparc | secreted protein, acidic, cysteine-rich (osteonectin) | 8364 | XB-GENE-1009630 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321357 | sparc | secreted protein, acidic, cysteine-rich (osteonectin) | 7955 | ZDB-GENE-030131-9 | Inparanoid, OMA |
| C. elegans | 176931 | ost-1 | OSTeonectin (SPARC) related | 6239 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / extracellular matrix protein / cell adhesion molecule / SPARC
protein / extracellular matrix protein / extracellular matrix glycoprotein / SPARC
protein / extracellular matrix protein / growth factor / SPARC
protein / extracellular matrix protein / cell adhesion molecule / SPARC
protein / extracellular matrix protein / extracellular matrix glycoprotein / SPARC
protein / extracellular matrix protein / growth factor / SPARC
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifiche | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Ricordamelo più tardi
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.