🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

USP30

DescrizioneUbiquitin carboxyl-terminal hydrolase 30

Gene and Protein Information

Gene ID84749
Uniprot Accession IDs Q70CQ3 Q8WTU7 Q96JX4 Q9BSS3
Ensembl ID ENSP00000257548
FamilyBelongs to the peptidase C19 family.
Sequence
MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp452215USP30ubiquitin specific peptidase 309598VGNC:13490OMA, EggNOG
Macaque706607USP30ubiquitin specific peptidase 309544Inparanoid, OMA, EggNOG
Mouse100756Usp30ubiquitin specific peptidase 3010090MGI:2140991Inparanoid, OMA, EggNOG
Rat304579Usp30ubiquitin specific peptidase 3010116RGD:1307949Inparanoid, OMA, EggNOG
Dog611662USP30ubiquitin specific peptidase 309615VGNC:52974Inparanoid, OMA, EggNOG
Horse100066762USP30ubiquitin specific peptidase 309796VGNC:50985Inparanoid, OMA, EggNOG
Cow100140210USP30ubiquitin specific peptidase 309913VGNC:53928Inparanoid, OMA, EggNOG
Pig100520333ALKBH2alkB homolog 2, alpha-ketoglutarate dependent dioxygenase9823OMA, EggNOG
OpossumUSP30ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065]13616Inparanoid, OMA, EggNOG
PlatypusUSP30ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065]9258OMA, EggNOG
Xenopus733894usp30ubiquitin specific peptidase 308364XB-GENE-981069Inparanoid, OMA, EggNOG
Zebrafish559099usp30ubiquitin specific peptidase 307955ZDB-GENE-060526-335Inparanoid, OMA, EggNOG
C. elegans175310Y67D2.2Ubiquitin carboxyl-terminal hydrolase6239OMA, EggNOG
Fruitfly31519Usp30Ubiquitin specific protease 307227FBgn0029819Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.