🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ATP6V1D

DescrizioneV-type proton ATPase subunit D

Gene and Protein Information

Gene ID51382
Uniprot Accession IDs Q9Y5K8 B2RE33 Q9Y688 V-ATPase subunit D
Ensembl ID ENSP00000216442
Symbol ATP6M VATD VATD VMA8 ATP6M
FamilyBelongs to the V-ATPase D subunit family.
Sequence
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp452979ATP6V1DATPase H+ transporting V1 subunit D9598VGNC:7643OMA, EggNOG
Macaque710240ATP6V1DATPase H+ transporting V1 subunit D9544Inparanoid, OMA, EggNOG
Mouse73834Atp6v1dATPase, H+ transporting, lysosomal V1 subunit D10090MGI:1921084Inparanoid, OMA, EggNOG
Rat299159Atp6v1dATPase H+ transporting V1 subunit D10116RGD:735119Inparanoid, OMA, EggNOG
Dog480360ATP6V1DATPase H+ transporting V1 subunit D9615VGNC:38280Inparanoid, OMA, EggNOG
Horse100052659ATP6V1DATPase H+ transporting V1 subunit D9796VGNC:15680Inparanoid, OMA, EggNOG
Cow404152ATP6V1DATPase H+ transporting V1 subunit D9913VGNC:26321Inparanoid, OMA, EggNOG
Platypus100074235ATP6V1DATPase H+ transporting V1 subunit D9258Inparanoid, OMA, EggNOG
Chicken423280ATP6V1DATPase H+ transporting V1 subunit D9031CGNC:7286Inparanoid, OMA, EggNOG
Anole lizard100555090atp6v1dATPase H+ transporting V1 subunit D28377Inparanoid, OMA, EggNOG
Xenopus549829atp6v1dATPase, H+ transporting, lysosomal 34kDa, V1 subunit D8364XB-GENE-973447Inparanoid, OMA, EggNOG
Zebrafish393935atp6v1dATPase H+ transporting V1 subunit D7955ZDB-GENE-040426-727Inparanoid, OMA, EggNOG
C. elegans176338vha-14V-type proton ATPase subunit D6239Inparanoid, OMA, EggNOG
S.cerevisiae856659VMA8H(+)-transporting V1 sector ATPase subunit D4932S000000777Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    F-type and V-type ATPases    /    V-type ATPase    /    V-type proton ATPase subunit D

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.