🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

SLC32A1

DescrizioneVesicular inhibitory amino acid transporter

Gene and Protein Information

Gene ID140679
Uniprot Accession IDs Q9H598 Q8N489
Ensembl ID ENSP00000217420
Symbol VGAT VIAAT VGAT VIAAT
FamilyBelongs to the amino acid/polyamine transporter 2 family.
Sequence
MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYLTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPACYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp469940SLC32A1solute carrier family 32 member 19598VGNC:9984OMA, EggNOG
Macaque698315SLC32A1solute carrier family 32 member 19544Inparanoid, OMA, EggNOG
Mouse22348Slc32a1solute carrier family 32 (GABA vesicular transporter), member 110090MGI:1194488Inparanoid, OMA, EggNOG
Rat83612Slc32a1solute carrier family 32 member 110116RGD:621402Inparanoid, OMA, EggNOG
Dog485870SLC32A1solute carrier family 32 member 19615VGNC:46356Inparanoid, OMA, EggNOG
Horse100146532SLC32A1solute carrier family 32 member 19796VGNC:23157Inparanoid, OMA, EggNOG
Cow100301361SLC32A1solute carrier family 32 member 19913VGNC:34815Inparanoid, OMA, EggNOG
Pig100517013SLC32A1solute carrier family 32 member 19823OMA, EggNOG
Opossum100029278SLC32A1solute carrier family 32 member 113616Inparanoid, EggNOG
Chicken419167SLC32A1solute carrier family 32 member 19031CGNC:2585Inparanoid, OMA
Anole lizard100553313slc32a1solute carrier family 32 member 128377Inparanoid, OMA, EggNOG
Xenopus448348slc32a1solute carrier family 32 member 18364XB-GENE-489830Inparanoid, OMA, EggNOG
Zebrafish798575slc32a1solute carrier family 32 (GABA vesicular transporter), member 17955ZDB-GENE-061201-1Inparanoid, OMA, EggNOG
C. elegans176431unc-47Vesicular GABA transporter6239Inparanoid, OMA, EggNOG
Fruitfly36574VGATVesicular GABA Transporter7227FBgn0033911Inparanoid, EggNOG
S.cerevisiae853457AVT1Avt1p4932S000003761OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    amino acid transporter    /    Vesicular inhibitory amino acid transporter
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC32 vesicular inhibitory amino acid transporter    /    Vesicular inhibitory amino acid transporter

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.