🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ID4

DescrizioneDNA-binding protein inhibitor ID-4

Gene and Protein Information

Gene ID3400
Uniprot Accession IDs P47928 Q13005
Ensembl ID ENSP00000367972
Symbol BHLHB27 IDB4 bHLHb27
Sequence
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque705825ID4inhibitor of DNA binding 4, HLH protein9544Inparanoid, OMA, EggNOG
Mouse15904Id4inhibitor of DNA binding 410090MGI:99414Inparanoid, OMA, EggNOG
Rat291023Id4inhibitor of DNA binding 4, HLH protein10116RGD:631428Inparanoid, OMA, EggNOG
HorseID4inhibitor of DNA binding 4, HLH protein [Source:HGNC Symbol;Acc:HGNC:5363]9796OMA, EggNOG
Pig100144508ID4inhibitor of DNA binding 4, HLH protein9823Inparanoid, OMA, EggNOG
Opossum100018112ID4inhibitor of DNA binding 4, HLH protein13616Inparanoid, OMA, EggNOG
Anole lizardID4inhibitor of DNA binding 4, HLH protein [Source:HGNC Symbol;Acc:HGNC:5363]28377Inparanoid, EggNOG
Xenopus448114id4inhibitor of DNA binding 4, HLH protein8364XB-GENE-876360Inparanoid, OMA, EggNOG
Zebrafish664761id4inhibitor of DNA binding 47955ZDB-GENE-051113-208Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.