🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ME2

DescrizioneNAD-dependent malic enzyme, mitochondrial

Gene and Protein Information

Gene ID4200
Uniprot Accession IDs P23368 B2R8J2 Q9BWL6 Q9BYG1 Q9H4B2 NAD-ME
Ensembl ID ENSP00000321070
Symbol ODS1
FamilyBelongs to the malic enzymes family.
Sequence
MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp455422ME2malic enzyme 29598VGNC:10005OMA, EggNOG
Macaque711129ME2malic enzyme 29544Inparanoid, OMA, EggNOG
Mouse107029Me2malic enzyme 2, NAD(+)-dependent, mitochondrial10090MGI:2147351Inparanoid, OMA, EggNOG
Rat307270Me2malic enzyme 210116RGD:1310321Inparanoid, OMA, EggNOG
Dog476198ME2malic enzyme 29615VGNC:43110Inparanoid, OMA, EggNOG
Horse100069637ME2malic enzyme 29796VGNC:20062Inparanoid, OMA, EggNOG
Cow507817ME2malic enzyme 29913VGNC:31340Inparanoid, OMA, EggNOG
Pig100524659ME2malic enzyme 29823Inparanoid, OMA, EggNOG
Opossum100010878ME2malic enzyme 213616Inparanoid, OMA, EggNOG
Platypus100078022ME2malic enzyme 29258Inparanoid, OMA, EggNOG
Anole lizard100552684me2malic enzyme 228377Inparanoid, OMA, EggNOG
Xenopus548395me2malic enzyme 2, NAD(+)-dependent, mitochondrial8364XB-GENE-943055Inparanoid, OMA, EggNOG
Zebrafish445233me2malic enzyme 2, NAD(+)-dependent, mitochondrial7955ZDB-GENE-040801-147Inparanoid, OMA
S.cerevisiae853839MAE1malate dehydrogenase (oxaloacetate-decarboxylating)4932S000001512Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    NAD-dependent malic enzyme, mitochondrial
protein    /    oxidoreductase    /    decarboxylase    /    NAD-dependent malic enzyme, mitochondrial
protein    /    oxidoreductase    /    acyltransferase    /    NAD-dependent malic enzyme, mitochondrial
DTO Classes
protein    /    Enzyme    /    Lyase    /    Decarboxylase    /    NAD-dependent malic enzyme, mitochondrial

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.