🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

IFNG

DescrizioneInterferon gamma

Gene and Protein Information

Gene ID3458
Uniprot Accession IDs P01579 B5BU88 Q53ZV4 IFN-gamma
Ensembl ID ENSP00000229135
Symbol IFG IFI
FamilyBelongs to the type II (or gamma) interferon family.
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp449517IFNGinterferon gamma9598Inparanoid, OMA, EggNOG
Macaque574282IFNGinterferon gamma9544Inparanoid, OMA, EggNOG
Mouse15978Ifnginterferon gamma10090MGI:107656Inparanoid, OMA, EggNOG
Rat25712Ifnginterferon gamma10116RGD:2866Inparanoid, OMA, EggNOG
Dog403801IFNGinterferon gamma9615VGNC:41879Inparanoid, OMA, EggNOG
Horse100034181IFNGinterferon gamma9796VGNC:18951Inparanoid, OMA, EggNOG
Cow281237IFNGinterferon gamma9913VGNC:30057Inparanoid, OMA, EggNOG
Platypus100080275IFNGinterferon gamma9258Inparanoid, OMA, EggNOG
Chicken396054IFNGinterferon gamma9031CGNC:7521Inparanoid, OMA, EggNOG
Xenopus100216446ifnginterferon, gamma8364XB-GENE-488149Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.