🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

FFAR2

DescrizioneFree fatty acid receptor 2

Gene and Protein Information

Gene ID2867
Uniprot Accession IDs O15552 B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5
Ensembl ID ENSP00000473159
Symbol FFA2 GPCR43 GPR43 FFA2R GPR43
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp455948FFAR2free fatty acid receptor 29598VGNC:11096OMA, EggNOG
Macaque709026FFAR2free fatty acid receptor 29544Inparanoid, OMA, EggNOG
Mouse233079Ffar2free fatty acid receptor 210090MGI:2441731Inparanoid, OMA, EggNOG
Rat292794Ffar2free fatty acid receptor 210116RGD:1359614Inparanoid, OMA, EggNOG
Dog484580FFAR2free fatty acid receptor 29615VGNC:40831Inparanoid, OMA, EggNOG
Horse100059449FFAR2free fatty acid receptor 29796VGNC:51028Inparanoid, OMA, EggNOG
Cow522431FFAR2free fatty acid receptor 29913OMA, EggNOG
Opossum100015816FFAR2free fatty acid receptor 213616Inparanoid, OMA, EggNOG
PlatypusFFAR2free fatty acid receptor 2 [Source:HGNC Symbol;Acc:HGNC:4501]9258OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.