224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | Solute carrier family 2, facilitated glucose transporter member 3 |
|---|
Gene and Protein Information
| Gene ID | 6515 |
|---|---|
| Uniprot Accession IDs | P11169 B2R606 D3DUU6 Q6I9U2 Q9UG15 |
| Ensembl ID | ENSP00000075120 |
| Symbol | GLUT3 GLUT3 |
| Family | Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. |
| Sequence | MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV Mostra altro |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 451818 | SLC2A3 | solute carrier family 2 member 3 | 9598 | VGNC:13447 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC2 family of hexose and sugar alcohol transporters / Class I transporters / Solute carrier family 2, facilitated glucose transporter member 3
protein / Transporter / SLC superfamily of solute carriers / SLC2 family of hexose and sugar alcohol transporters / Class I transporters / Solute carrier family 2, facilitated glucose transporter member 3
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.