🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

SLC2A8

DescrizioneSolute carrier family 2, facilitated glucose transporter member 8

Gene and Protein Information

Gene ID29988
Uniprot Accession IDs Q9NY64 Q8WUZ9 Q9NSC4
Ensembl ID ENSP00000362469
Symbol GLUT8 GLUTX1 GLUT8 GLUTX1
FamilyBelongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Sequence
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp739414SLC2A8solute carrier family 2 member 89598VGNC:8933OMA, EggNOG
Macaque701073SLC2A8solute carrier family 2 member 89544Inparanoid, OMA, EggNOG
Mouse56017Slc2a8solute carrier family 2, (facilitated glucose transporter), member 810090MGI:1860103Inparanoid, OMA, EggNOG
Rat85256Slc2a8solute carrier family 2 member 810116RGD:620611Inparanoid, OMA, EggNOG
Dog480717SLC2A8solute carrier family 2 member 89615VGNC:46344Inparanoid, OMA, EggNOG
Horse100070552SLC2A8solute carrier family 2 member 89796VGNC:23145Inparanoid, OMA, EggNOG
Cow282867SLC2A8solute carrier family 2 member 89913VGNC:34803Inparanoid, OMA, EggNOG
Pig100125551SLC2A8solute carrier family 2 member 89823Inparanoid, OMA, EggNOG
Opossum100020584SLC2A8solute carrier family 2 member 813616Inparanoid, EggNOG
Chicken378802SLC2A8solute carrier family 2 member 89031CGNC:49126Inparanoid, OMA
Anole lizard100566203slc2a8solute carrier family 2 member 828377Inparanoid, OMA
Xenopus100486943slc2a8solute carrier family 2 member 88364XB-GENE-492572Inparanoid, OMA
Zebrafish373140slc2a8solute carrier family 2 (facilitated glucose transporter), member 87955ZDB-GENE-030829-25Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.