🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

HAT1

DescrizioneHistone acetyltransferase type B catalytic subunit

Gene and Protein Information

Gene ID8520
Uniprot Accession IDs O14929 Q49A44 Q53QF0 Q53SU4 Q6P594 Q8WWB9
Ensembl ID ENSP00000264108
Symbol KAT1 KAT1
FamilyBelongs to the HAT1 family.
Sequence
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp459737HAT1histone acetyltransferase 19598VGNC:1956OMA, EggNOG
Macaque695933HAT1histone acetyltransferase 19544Inparanoid, OMA, EggNOG
Mouse107435Hat1histone aminotransferase 110090MGI:96013Inparanoid, OMA, EggNOG
Rat296501Hat1histone acetyltransferase 110116RGD:1305716Inparanoid, OMA, EggNOG
Dog478799HAT1histone acetyltransferase 19615VGNC:50624Inparanoid, OMA, EggNOG
Horse100063802HAT1histone acetyltransferase 19796VGNC:50591Inparanoid, OMA, EggNOG
Cow509329HAT1histone acetyltransferase 19913VGNC:49063Inparanoid, OMA, EggNOG
Pig100622317HAT1histone acetyltransferase 19823OMA, EggNOG
Opossum100025069HAT1histone acetyltransferase 113616Inparanoid, OMA, EggNOG
PlatypusHAT1histone acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4821]9258OMA, EggNOG
Chicken374037HAT1histone acetyltransferase 19031CGNC:7250Inparanoid, OMA, EggNOG
Anole lizard100554251hat1histone acetyltransferase 128377Inparanoid, OMA, EggNOG
Xenopus100145138hat1histone acetyltransferase 18364XB-GENE-952148Inparanoid, OMA, EggNOG
Zebrafish447833hat1histone acetyltransferase 17955ZDB-GENE-040912-99Inparanoid, OMA, EggNOG
C. elegans176458hat-1Histone AcetylTransferase6239Inparanoid, OMA
S.cerevisiae856106HAT1histone acetyltransferase catalytic subunit HAT14932S000005922Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    acetyltransferase    /    Histone acetyltransferase type B catalytic subunit
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acetyltransferase    /    Histone acetyltransferase type B catalytic subunit

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.