🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

HLF

DescrizioneHepatic leukemia factor

Gene and Protein Information

Gene ID3131
Uniprot Accession IDs Q16534 A8K1X8 Q6FHS9
Ensembl ID ENSP00000226067
FamilyBelongs to the bZIP family. PAR subfamily.
Sequence
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp455140HLFHLF, PAR bZIP transcription factor9598VGNC:10210OMA, EggNOG
Macaque706623HLFHLF, PAR bZIP transcription factor9544Inparanoid, OMA, EggNOG
Mouse217082Hlfhepatic leukemia factor10090MGI:96108Inparanoid, OMA, EggNOG
Rat690286HlfHLF, PAR bZIP transcription factor10116RGD:1582828Inparanoid, OMA, EggNOG
Dog609564HLFHLF, PAR bZIP transcription factor9615VGNC:49094Inparanoid, OMA, EggNOG
Horse100070549HLFHLF, PAR bZIP transcription factor9796VGNC:50481Inparanoid, OMA, EggNOG
Cow516069HLFHLF, PAR bZIP transcription factor9913VGNC:50275Inparanoid, OMA, EggNOG
Opossum100012192HLFHLF, PAR bZIP transcription factor13616Inparanoid, OMA, EggNOG
Platypus100093311HLFHLF, PAR bZIP transcription factor9258Inparanoid, OMA, EggNOG
Chicken417395HLFHLF, PAR bZIP transcription factor9031CGNC:2216Inparanoid, OMA, EggNOG
Anole lizard100567087hlfHLF, PAR bZIP transcription factor28377Inparanoid, OMA, EggNOG
Xenopus100489797hlfhepatic leukemia factor8364XB-GENE-955698Inparanoid, OMA, EggNOG
Zebrafish768192hlfahepatic leukemia factor a7955ZDB-GENE-061013-159Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.