🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GPR18

DescrizioneN-arachidonyl glycine receptor

Gene and Protein Information

Gene ID2841
Uniprot Accession IDs Q14330 Q6GTM3 Q96HI6 Q9H2L2 NAGly receptor
Ensembl ID ENSP00000343428
Symbol GPCRW
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp738311GPR18G protein-coupled receptor 189598VGNC:5065OMA, EggNOG
Macaque698714GPR18G protein-coupled receptor 189544Inparanoid, OMA
Mouse110168Gpr18G protein-coupled receptor 1810090MGI:107859Inparanoid, OMA, EggNOG
Rat679957Gpr18G protein-coupled receptor 1810116RGD:1304889Inparanoid, OMA, EggNOG
Dog485531GPR18G protein-coupled receptor 189615VGNC:41420Inparanoid, OMA, EggNOG
Horse100147633GPR18G protein-coupled receptor 189796VGNC:18531Inparanoid, OMA, EggNOG
Cow540038GPR18G protein-coupled receptor 189913VGNC:29574Inparanoid, OMA, EggNOG
Chicken100858263GPR18G protein-coupled receptor 189031CGNC:66127OMA, EggNOG
Anole lizard103278302gpr18G protein-coupled receptor 1828377Inparanoid, OMA, EggNOG
XenopusGPR18G protein-coupled receptor 18 [Source:HGNC Symbol;Acc:HGNC:4472]8364OMA, EggNOG
Zebrafish556711gpr18G protein-coupled receptor 187955ZDB-GENE-070912-159Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    N-arachidonyl glycine receptor

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.