🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GPR1

DescrizioneG-protein coupled receptor 1

Gene and Protein Information

Gene ID2825
Uniprot Accession IDs P46091 A5JUU6 A8K4L1 Q53TR9 Q6NVX4
Ensembl ID ENSP00000480405
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp470621GPR1G protein-coupled receptor 19598VGNC:1948OMA, EggNOG
Macaque707120GPR1G protein-coupled receptor 19544Inparanoid, OMA, EggNOG
Mouse241070Gpr1G protein-coupled receptor 110090MGI:2385324Inparanoid, OMA, EggNOG
Rat25457Gpr1G protein-coupled receptor 110116RGD:2728Inparanoid, OMA, EggNOG
Dog478882GPR1G protein-coupled receptor 19615VGNC:41390Inparanoid, OMA, EggNOG
Horse100068488GPR1G protein-coupled receptor 19796VGNC:18504Inparanoid, OMA, EggNOG
Cow509707GPR1G protein-coupled receptor 19913VGNC:29542Inparanoid, OMA, EggNOG
Pig100415936GPR1G protein-coupled receptor 19823Inparanoid, OMA, EggNOG
Opossum100017108GPR1G protein-coupled receptor 113616Inparanoid, OMA, EggNOG
Platypus100083855GPR1G protein-coupled receptor 19258Inparanoid, OMA, EggNOG
Chicken424101GPR1G protein-coupled receptor 19031CGNC:6515Inparanoid, OMA, EggNOG
Anole lizard100552338gpr1G protein-coupled receptor 128377Inparanoid, OMA, EggNOG
XenopusGPR1G protein-coupled receptor 1 [Source:HGNC Symbol;Acc:HGNC:4463]8364OMA, EggNOG
Zebrafish100004124gpr1G protein-coupled receptor 17955ZDB-GENE-091204-457Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 1

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.