🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

FCGRT

DescrizioneIgG receptor FcRn large subunit p51

Gene and Protein Information

Gene ID2217
Uniprot Accession IDs P55899 Q5HYM5 Q9HBV7 Q9NZ19 FcRn
Ensembl ID ENSP00000221466
Symbol FCRN FCRN alpha-chain
FamilyBelongs to the immunoglobulin superfamily.
Sequence
MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp456208FCGRTFc fragment of IgG receptor and transporter9598VGNC:7558Inparanoid, OMA, EggNOG
Macaque718859FCGRTFc fragment of IgG receptor and transporter9544Inparanoid, OMA, EggNOG
Mouse14132FcgrtFc receptor, IgG, alpha chain transporter10090MGI:103017Inparanoid, OMA, EggNOG
Rat29558FcgrtFc fragment of IgG receptor and transporter10116RGD:61811Inparanoid, OMA, EggNOG
Dog476414FCGRTFc fragment of IgG receptor and transporter9615VGNC:40803Inparanoid, OMA, EggNOG
Horse100147583FCGRTFc fragment of IgG receptor and transporter9796VGNC:17976Inparanoid, OMA, EggNOG
Cow338062FCGRTFc fragment of IgG receptor and transporter9913VGNC:28934Inparanoid, OMA, EggNOG
Pig397399FCGRTFc fragment of IgG receptor and transporter9823OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.