🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CDX1

DescrizioneHomeobox protein CDX-1

Gene and Protein Information

Gene ID1044
Uniprot Accession IDs P47902 Q4VAU4 Q9NYK8
Ensembl ID ENSP00000231656
FamilyBelongs to the Caudal homeobox family.
Sequence
MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp471693CDX1caudal type homeobox 19598VGNC:11880OMA, EggNOG
Mouse12590Cdx1caudal type homeobox 110090MGI:88360Inparanoid, OMA, EggNOG
Dog612256CDX1caudal type homeobox 19615VGNC:39084Inparanoid, OMA, EggNOG
Pig100626275CDX1caudal type homeobox 19823OMA, EggNOG
Opossum100024158CDX1caudal type homeobox 113616Inparanoid, EggNOG
Chicken395397CDX1caudal type homeobox 19031CGNC:4232OMA, EggNOG
Anole lizard100564110cdx1caudal type homeobox 128377Inparanoid, EggNOG
Xenopus395055cdx1caudal type homeobox 18364XB-GENE-485396Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Homeobox protein CDX-1
protein    /    nucleic acid binding    /    homeodomain transcription factor    /    Homeobox protein CDX-1
DTO Classes
protein    /    Transcription factor    /    Helix-turn-helix transcription factor    /    Homeodomain transcription factor    /    Homeobox protein CDX-1

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.