🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

FCER1G

DescrizioneHigh affinity immunoglobulin epsilon receptor subunit gamma

Gene and Protein Information

Gene ID2207
Uniprot Accession IDs P30273 Q5VTW4
Ensembl ID ENSP00000289902
Symbol FCRG
FamilyBelongs to the CD3Z/FCER1G family.
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp100612300FCER1GFc fragment of IgE receptor Ig9598VGNC:6818OMA, EggNOG
Macaque720291FCER1GFc fragment of IgE receptor Ig9544Inparanoid, OMA, EggNOG
Mouse14127Fcer1gFc receptor, IgE, high affinity I, gamma polypeptide10090MGI:95496Inparanoid, OMA, EggNOG
Rat25441Fcer1gFc fragment of IgE receptor Ig10116RGD:2599Inparanoid, OMA, EggNOG
Dog403798FCER1GFc fragment of IgE receptor Ig9615VGNC:40802Inparanoid, OMA, EggNOG
Horse100034137FCER1GFc fragment of IgE receptor Ig9796VGNC:17973OMA, EggNOG
Cow282226FCER1GFc fragment of IgE receptor Ig9913VGNC:28931Inparanoid, OMA, EggNOG
Pig397406FCER1GFc fragment of IgE receptor Ig9823Inparanoid, OMA, EggNOG
OpossumFCER1GFc fragment of IgE receptor Ig [Source:HGNC Symbol;Acc:HGNC:3611]13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.