🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

HSPB1

DescrizioneHeat shock protein beta-1

Gene and Protein Information

Gene ID3315
Uniprot Accession IDs P04792 B2R4N8 Q6FI47 Q96C20 Q96EI7 Q9UC31 Q9UC34 Q9UC35 Q9UC36 HspB1
Ensembl ID ENSP00000248553
Symbol HSP27 HSP28 CMT2F HMN2B HSP27 HSP28 Hsp25 SRP27 HS.76067 HEL-S-102
FamilyBelongs to the small heat shock protein (HSP20) family.
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp463488HSPB1heat shock protein family B (small) member 19598VGNC:7394OMA, EggNOG
Macaque715615HSPB1heat shock protein family B (small) member 19544Inparanoid, OMA, EggNOG
Mouse15507Hspb1heat shock protein 110090MGI:96240Inparanoid, OMA, EggNOG
Rat24471Hspb1heat shock protein family B (small) member 110116RGD:61306Inparanoid, OMA, EggNOG
Dog403979HSPB1heat shock protein family B (small) member 19615VGNC:53534Inparanoid, OMA, EggNOG
Horse100059763HSPB1heat shock protein family B (small) member 19796VGNC:51154Inparanoid, OMA, EggNOG
Cow516099HSPB1heat shock protein family B (small) member 19913Inparanoid, OMA, EggNOG
Pig493184HSPB1heat shock protein family B (small) member 19823Inparanoid, EggNOG
Opossum100029144HSPB1heat shock protein family B (small) member 113616Inparanoid, OMA, EggNOG
Chicken396227HSPB1heat shock protein family B (small) member 19031CGNC:1361Inparanoid, OMA, EggNOG
Xenopus780278hspb1heat shock protein family B (small) member 18364XB-GENE-480320Inparanoid, OMA, EggNOG
Zebrafish368243hspb1heat shock protein, alpha-crystallin-related, 17955ZDB-GENE-030326-4Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.