🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

HSPB6

DescrizioneHeat shock protein beta-6

Gene and Protein Information

Gene ID126393
Uniprot Accession IDs O14558 O14551 Q6NVI3 Q96MG9 HspB6
Ensembl ID ENSP00000468057
Symbol HEL55 Hsp20 PPP1R91
FamilyBelongs to the small heat shock protein (HSP20) family.
Sequence
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp745747HSPB6heat shock protein family B (small) member 69598VGNC:13182OMA, EggNOG
Macaque710760HSPB6heat shock protein family B (small) member 69544Inparanoid, OMA, EggNOG
Mouse243912Hspb6heat shock protein, alpha-crystallin-related, B610090MGI:2685325Inparanoid, OMA, EggNOG
Rat192245Hspb6heat shock protein family B (small) member 610116RGD:621554Inparanoid, OMA, EggNOG
Dog484574HSPB6heat shock protein family B (small) member 69615VGNC:53526Inparanoid, OMA, EggNOG
Horse100146605HSPB6heat shock protein family B (small) member 69796VGNC:51039Inparanoid, OMA, EggNOG
Cow534551HSPB6heat shock protein family B (small) member 69913Inparanoid, OMA, EggNOG
Pig494560HSPB6heat shock protein family B (small) member 69823OMA, EggNOG
OpossumHSPB6heat shock protein family B (small) member 6 [Source:HGNC Symbol;Acc:HGNC:26511]13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.