🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

HSPBP1

DescrizioneHsp70-binding protein 1

Gene and Protein Information

Gene ID23640
Uniprot Accession IDs Q9NZL4 B3KQP0 B4DG11 O95351 Q6ZNU5 HspBP1
Ensembl ID ENSP00000255631
Symbol HSPBP FES1
Sequence
MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp456299HSPBP1HSPA (Hsp70) binding protein 19598VGNC:13184OMA, EggNOG
MacaqueHSPBP1HSPA (Hsp70) binding protein 1 [Source:HGNC Symbol;Acc:HGNC:24989]9544OMA, EggNOG
Mouse66245Hspbp1HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 110090MGI:1913495Inparanoid, OMA, EggNOG
Rat246146Hspbp1HSPA (Hsp70) binding protein 110116RGD:628677Inparanoid, OMA, EggNOG
Dog476381HSPBP1HSPA (Hsp70) binding protein 19615VGNC:53527Inparanoid, OMA, EggNOG
Horse100050496HSPBP1HSPA (Hsp70) binding protein 19796VGNC:51040Inparanoid, OMA, EggNOG
Cow512757HSPBP1HSPA (Hsp70) binding protein 19913Inparanoid, OMA, EggNOG
Pig100518376HSPBP1HSPA (Hsp70) binding protein 19823OMA, EggNOG
Opossum100017290HSPBP1HSPA (Hsp70) binding protein 113616Inparanoid, OMA, EggNOG
Anole lizard100561715hspbp1HSPA (Hsp70) binding protein 128377Inparanoid, OMA, EggNOG
Xenopus548823hspbp1HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 18364XB-GENE-1007205Inparanoid, OMA, EggNOG
Zebrafish338155hspbp1HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 17955ZDB-GENE-030219-55Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.