🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PDAP1

Descrizione28 kDa heat- and acid-stable phosphoprotein

Gene and Protein Information

Gene ID11333
Uniprot Accession IDs Q13442 D6W5S5 Q92906
Ensembl ID ENSP00000222968
Symbol HASPP28 PAP PAP1 HASPP28
FamilyBelongs to the PDAP1 family.
Sequence
MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp737403PDAP1PDGFA associated protein 19598VGNC:4460OMA, EggNOG
Macaque707779PDAP1PDGFA associated protein 19544Inparanoid, OMA, EggNOG
Mouse231887Pdap1PDGFA associated protein 110090MGI:2448536Inparanoid, OMA, EggNOG
Rat64527Pdap1PDGFA associated protein 110116RGD:620442Inparanoid, OMA, EggNOG
Dog489861PDAP1PDGFA associated protein 19615VGNC:44332Inparanoid, OMA, EggNOG
Horse100063675PDAP1PDGFA associated protein 19796VGNC:21225Inparanoid, OMA, EggNOG
Cow100139074PDAP1PDGFA associated protein 19913VGNC:32655Inparanoid, OMA, EggNOG
Opossum100016083PDAP1PDGFA associated protein 113616Inparanoid, OMA, EggNOG
PlatypusPDAP1PDGFA associated protein 1 [Source:HGNC Symbol;Acc:HGNC:14634]9258OMA, EggNOG
Anole lizard100557789pdap1PDGFA associated protein 128377Inparanoid, OMA, EggNOG
Xenopus100135404pdap1PDGFA associated protein 18364XB-GENE-6257964Inparanoid, OMA, EggNOG
Zebrafish393179pdap1bpdgfa associated protein 1b7955ZDB-GENE-040426-942Inparanoid, OMA
Zebrafish322973pdap1apdgfa associated protein 1a7955ZDB-GENE-030131-1693OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.