🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MESP2

DescrizioneMesoderm posterior protein 2

Gene and Protein Information

Gene ID145873
Uniprot Accession IDs Q0VG99 Q7RTU2
Ensembl ID ENSP00000342392
Symbol BHLHC6 SCDO2 SCDO2 bHLHc6
Sequence
MAQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQGQGQGQGQGQGQGQGQGQGQGQGQGRRPGLVSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWATPPYCPKIQSPPYSSQGTTSDASLWTPPQGCPWTQSSPEPRNPPVPWTAAPATLELAAVYQGLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPGRCWSHSAEVVPNSEDQGPGAAFQLSEASPPQSSGLRFSGCPELWQEDLEGARLGIFY
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp467757MESP2mesoderm posterior bHLH transcription factor 29598VGNC:1920OMA, EggNOG
Macaque701003MESP2mesoderm posterior bHLH transcription factor 29544Inparanoid, OMA, EggNOG
Mouse17293Mesp2mesoderm posterior 210090MGI:1096325Inparanoid, OMA, EggNOG
Rat293046Mesp2mesoderm posterior bHLH transcription factor 210116RGD:1305959Inparanoid, OMA, EggNOG
Dog100683170MESP2mesoderm posterior bHLH transcription factor 29615VGNC:43164Inparanoid, OMA, EggNOG
Cow615145MESP2mesoderm posterior bHLH transcription factor 29913VGNC:53945Inparanoid, OMA, EggNOG
Pig100153433MESP2mesoderm posterior bHLH transcription factor 29823OMA, EggNOG
Opossum100015370MESP2mesoderm posterior bHLH transcription factor 213616Inparanoid, EggNOG
Zebrafish58069mespaamesoderm posterior aa7955ZDB-GENE-000406-8Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.