🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

AK1

DescrizioneAdenylate kinase isoenzyme 1

Gene and Protein Information

Gene ID203
Uniprot Accession IDs P00568 Q9BVK9 Q9UQC7 AK 1
Ensembl ID ENSP00000362271
Symbol HTL-S-58j
FamilyBelongs to the adenylate kinase family. AK1 subfamily.
Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp464756AK1adenylate kinase 19598VGNC:13849OMA, EggNOG
Mouse11636Ak1adenylate kinase 110090MGI:87977Inparanoid, OMA, EggNOG
Dog480712AK1adenylate kinase 19615VGNC:37745Inparanoid, OMA, EggNOG
Horse100070413AK1adenylate kinase 19796VGNC:15194Inparanoid, OMA, EggNOG
Cow280715AK1adenylate kinase 19913VGNC:25770Inparanoid, OMA, EggNOG
Pig100521423AK1adenylate kinase 19823Inparanoid, OMA, EggNOG
Opossum100011946AK1adenylate kinase 113616Inparanoid, EggNOG
Chicken396002AK1adenylate kinase 19031CGNC:49598Inparanoid, OMA
Anole lizard100561285ak1adenylate kinase 128377OMA, EggNOG
Zebrafish445486ak1adenylate kinase 17955ZDB-GENE-040822-37Inparanoid, OMA, EggNOG
C. elegans181317F38B2.4Adenylate kinase isoenzyme 16239Inparanoid, OMA, EggNOG
Fruitfly39396Adk1Adenylate kinase 17227FBgn0022709Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.