🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GPR15

DescrizioneG-protein coupled receptor 15

Gene and Protein Information

Gene ID2838
Uniprot Accession IDs P49685 Q3MIL4 Q6ISN6
Ensembl ID ENSP00000284311
Symbol BOB
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp450102GPR15G protein-coupled receptor 159598VGNC:7971Inparanoid, OMA, EggNOG
Macaque698718GPR15G protein-coupled receptor 159544Inparanoid, OMA, EggNOG
Mouse71223Gpr15G protein-coupled receptor 1510090MGI:1918473Inparanoid, OMA, EggNOG
Rat288181Gpr15G protein-coupled receptor 1510116RGD:1306639Inparanoid, OMA, EggNOG
Dog487947GPR15G protein-coupled receptor 159615VGNC:41404Inparanoid, OMA, EggNOG
Horse100072420GPR15G protein-coupled receptor 159796VGNC:18517Inparanoid, OMA, EggNOG
Cow538740GPR15G protein-coupled receptor 159913VGNC:29557Inparanoid, OMA, EggNOG
Pig100153787GPR15G protein-coupled receptor 159823OMA, EggNOG
Chicken427956GPR15G protein-coupled receptor 159031CGNC:11260Inparanoid, OMA, EggNOG
Anole lizard100567777gpr15G protein-coupled receptor 1528377Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 15

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.