🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GPR19

DescrizioneProbable G-protein coupled receptor 19

Gene and Protein Information

Gene ID2842
Uniprot Accession IDs Q15760
Ensembl ID ENSP00000441832
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MVFAHRMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTDLHYVLKPGEVATASIFFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVLLQFTTGRWTLGSATCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWVFDAGFVTPVLFFYGSNWDSHCNYFLPSSWEGTAYTVIHFLVGFVIPSVLIILFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLILNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSNAYTITTSSRMAKKNYVGISEIPSMAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp740660GPR19G protein-coupled receptor 199598VGNC:8599OMA, EggNOG
Macaque697072GPR19G protein-coupled receptor 199544Inparanoid, OMA, EggNOG
Mouse14760Gpr19G protein-coupled receptor 1910090MGI:892973Inparanoid, OMA, EggNOG
Rat312787Gpr19G protein-coupled receptor 1910116RGD:71045Inparanoid, OMA, EggNOG
Dog100686071GPR19G protein-coupled receptor 199615VGNC:41424Inparanoid, OMA, EggNOG
Horse100066597GPR19G protein-coupled receptor 199796VGNC:18534Inparanoid, OMA, EggNOG
Cow540647GPR19G protein-coupled receptor 199913VGNC:29578Inparanoid, OMA, EggNOG
Anole lizard100565265gpr19G protein-coupled receptor 1928377Inparanoid, OMA, EggNOG
Xenopus548962gpr19G protein-coupled receptor 198364XB-GENE-1009870Inparanoid, OMA, EggNOG
Zebrafish393969gpr19G protein-coupled receptor 197955ZDB-GENE-040426-1295Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Probable g-protein coupled receptor 19
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Probable g-protein coupled receptor 19

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.