🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TOMM40

DescrizioneMitochondrial import receptor subunit TOM40 homolog

Gene and Protein Information

Gene ID10452
Uniprot Accession IDs O96008 A0A024R0P9 Q86VW4 Q8WY09 Q8WY10 Q8WY11 Q9BR95
Ensembl ID ENSP00000410339
Symbol C19orf1 PEREC1 TOM40 TOM40 PEREC1 C19orf1 PER-EC1 D19S1177E
FamilyBelongs to the Tom40 family.
Sequence
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque713297TOMM40translocase of outer mitochondrial membrane 409544Inparanoid, OMA, EggNOG
Mouse53333Tomm40translocase of outer mitochondrial membrane 4010090MGI:1858259Inparanoid, OMA, EggNOG
Rat308416Tomm40translocase of outer mitochondrial membrane 4010116RGD:1303022Inparanoid, OMA, EggNOG
Dog611055TOMM40translocase of outer mitochondrial membrane 409615VGNC:49033Inparanoid, OMA
Horse100146715TOMM40translocase of outer mitochondrial membrane 409796VGNC:50512Inparanoid, OMA
Cow510219TOMM40translocase of outer mitochondrial membrane 409913VGNC:49148Inparanoid, OMA
Opossum100016132TOMM40translocase of outer mitochondrial membrane 4013616Inparanoid, OMA
Anole lizard100563052tomm40translocase of outer mitochondrial membrane 4028377Inparanoid, OMA
Xenopus394730tomm40translocase of outer mitochondrial membrane 40 homolog8364XB-GENE-995150Inparanoid, OMA
Zebrafish405895tomm40ltranslocase of outer mitochondrial membrane 40 homolog, like7955ZDB-GENE-040426-2319Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.