PTP4A2

DescrizioneProtein tyrosine phosphatase type IVA 2

Gene and Protein Information

Gene ID8073
Uniprot Accession IDs Q12974 A8K9I8 B4DM39 D3DPP0 E9PGJ6 O00649 Q15197 Q15259 Q15260 Q15261 R4GN50
Ensembl ID ENSP00000344909
Symbol PRL2 PTPCAAX2 HH13 OV-1 PRL2 HH7-2 PRL-2 PTP4A HU-PP-1 PTPCAAX2 ptp-IV1a ptp-IV1b
FamilyBelongs to the protein-tyrosine phosphatase family.
Sequence
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse19244Ptp4a2protein tyrosine phosphatase 4a210090MGI:1277117Inparanoid, OMA
Rat85237Ptp4a2protein tyrosine phosphatase type IVA, member 210116RGD:619786Inparanoid, OMA
Dog609835PTP4A2protein tyrosine phosphatase type IVA, member 29615VGNC:45162Inparanoid, OMA
Horse100056044PTP4A2protein tyrosine phosphatase type IVA, member 29796VGNC:49526Inparanoid, OMA
Cow614435PTP4A2protein tyrosine phosphatase type IVA, member 29913VGNC:33524Inparanoid, OMA
Opossum100025462PTP4A2protein tyrosine phosphatase type IVA, member 213616Inparanoid, OMA
Platypus100075173PTP4A2protein tyrosine phosphatase type IVA, member 29258Inparanoid, OMA
Chicken419649PTP4A2protein tyrosine phosphatase type IVA, member 29031CGNC:2373Inparanoid, OMA
Anole lizard100558759ptp4a2protein tyrosine phosphatase type IVA, member 228377Inparanoid, OMA
Xenopus549961ptp4a2protein tyrosine phosphatase type IVA, member 28364XB-GENE-1007312Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.