🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TMPRSS2

DescrizioneTransmembrane protease serine 2

Gene and Protein Information

Gene ID7113
Uniprot Accession IDs O15393 A8K6Z8 B2R8E5 B7Z459 D3DSJ2 F8WES1 Q6GTK7 Q9BXX1
Ensembl ID ENSP00000381588
Symbol PRSS10 PP9284 PRSS10
FamilyBelongs to the peptidase S1 family.
Sequence
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp474007TMPRSS2transmembrane serine protease 29598VGNC:3729OMA, EggNOG
Macaque715138TMPRSS2transmembrane protease, serine 29544OMA, EggNOG
Mouse50528Tmprss2transmembrane protease, serine 210090MGI:1354381Inparanoid, OMA, EggNOG
Rat156435Tmprss2transmembrane serine protease 210116RGD:620766Inparanoid, OMA, EggNOG
Dog487770TMPRSS2transmembrane serine protease 29615VGNC:53045Inparanoid, OMA, EggNOG
Horse100058498TMPRSS2transmembrane serine protease 29796VGNC:24341Inparanoid, OMA, EggNOG
Cow511037TMPRSS2transmembrane serine protease 29913VGNC:36140Inparanoid, OMA, EggNOG
Opossum100016391TMPRSS2transmembrane protease, serine 213616Inparanoid, OMA, EggNOG
Chicken418528TMPRSS2transmembrane protease, serine 29031CGNC:12069Inparanoid, OMA
Anole lizard100552320tmprss2transmembrane protease, serine 228377Inparanoid, OMA
Zebrafish494080tmprss2transmembrane serine protease 27955ZDB-GENE-041212-48Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.