PTP4A3

DescrizioneProtein tyrosine phosphatase type IVA 3

Gene and Protein Information

Gene ID11156
Uniprot Accession IDs O75365 Q8IVN5 Q99849 Q9BTW5
Ensembl ID ENSP00000332274
Symbol PRL3 PRL3 PRL-3 PRL-R
FamilyBelongs to the protein-tyrosine phosphatase family.
Sequence
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp737820PTP4A3protein tyrosine phosphatase type IVA, member 39598VGNC:50317Inparanoid, OMA, EggNOG
Macaque693703PTP4A3protein tyrosine phosphatase type IVA, member 39544Inparanoid, OMA
Mouse19245Ptp4a3protein tyrosine phosphatase 4a310090MGI:1277098Inparanoid, OMA, EggNOG
Rat362930Ptp4a3protein tyrosine phosphatase type IVA, member 310116RGD:1308687Inparanoid, OMA, EggNOG
Dog606961PTP4A3protein tyrosine phosphatase type IVA, member 39615VGNC:45163Inparanoid, OMA, EggNOG
Horse100058296PTP4A3protein tyrosine phosphatase type IVA, member 39796VGNC:22006Inparanoid, OMA, EggNOG
Cow100137722PTP4A3protein tyrosine phosphatase type IVA, member 39913VGNC:33525Inparanoid, OMA, EggNOG
Opossum100032775PTP4A3protein tyrosine phosphatase type IVA, member 313616Inparanoid, OMA, EggNOG
Anole lizard100554421ptp4a3protein tyrosine phosphatase type IVA, member 328377Inparanoid, OMA, EggNOG
Xenopus100216017ptp4a3protein tyrosine phosphatase type IVA, member 38364XB-GENE-943078Inparanoid, OMA
Zebrafish406460ptp4a3protein tyrosine phosphatase type IVA, member 37955ZDB-GENE-040426-2220Inparanoid, OMA, EggNOG
Fruitfly34952PRL-1PRL-1 phosphatase7227FBgn0024734Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.