🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TPSAB1

DescrizioneTryptase alpha/beta-1

Gene and Protein Information

Gene ID7177
Uniprot Accession IDs Q15661 D2E6R9 D2E6S1 P15157 Q15663 Q6B052 Q9H2Y4 Q9H2Y5 Q9UQI1 Tryptase-1
Ensembl ID ENSP00000343577
Symbol TPS1 TPS2 TPSB1 TPS1 TPS2 TPSB1 TPSB2 Tryptase-2
FamilyBelongs to the peptidase S1 family. Tryptase subfamily.
Sequence
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp468084LOC468084tryptase alpha/beta-1-like9598OMA, EggNOG
Macaque699599LOC699599tryptase alpha/beta-19544OMA, EggNOG
Mouse17229Tpsb2tryptase beta 210090MGI:96942OMA, EggNOG
Rat54271Tpsab1tryptase alpha/beta 110116RGD:3066OMA, EggNOG
Horse100033966RETret proto-oncogene9796OMA, EggNOG
Cow786948LOC786948tryptase-2-like9913OMA, EggNOG
Opossum100022090LOC100022090tryptase alpha/beta-1-like13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    peptide hormone    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    serine protease    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    protease inhibitor    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    calmodulin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    annexin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    receptor    /    Tryptase alpha/beta-1
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Tryptase alpha/beta-1

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.