🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PBK

DescrizioneLymphokine-activated killer T-cell-originated protein kinase

Gene and Protein Information

Gene ID55872
Uniprot Accession IDs Q96KB5 B4DX68 D3DST2 Q9NPD9 Q9NYL7 Q9NZK6
Ensembl ID ENSP00000428489
Symbol TOPK SPK CT84 TOPK HEL164 Nori-3
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp464496PBKPDZ binding kinase9598VGNC:825OMA, EggNOG
Macaque713242PBKPDZ binding kinase9544Inparanoid, OMA, EggNOG
Mouse52033PbkPDZ binding kinase10090MGI:1289156Inparanoid, OMA, EggNOG
Rat290326PbkPDZ binding kinase10116RGD:1309565Inparanoid, OMA, EggNOG
Dog477371PBKPDZ binding kinase9615Inparanoid, OMA, EggNOG
Horse100060789PBKPDZ binding kinase9796VGNC:21182Inparanoid, OMA, EggNOG
Cow534781PBKPDZ binding kinase9913Inparanoid, OMA, EggNOG
Pig100141310PBKPDZ binding kinase9823Inparanoid, OMA, EggNOG
Platypus100077802PBKPDZ binding kinase9258Inparanoid, OMA, EggNOG
Chicken422003PBKPDZ binding kinase9031CGNC:12423Inparanoid, OMA, EggNOG
Anole lizard100565867pbkPDZ binding kinase28377OMA, EggNOG
Xenopus496810pbkPDZ binding kinase8364XB-GENE-1017083Inparanoid, OMA, EggNOG
Zebrafish360218pbkPDZ binding kinase7955ZDB-GENE-030523-2Inparanoid, OMA, EggNOG
Fruitfly32753CG8173CG8173 gene product from transcript CG8173-RA7227FBgn0030864Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.