🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GPR20

DescrizioneG-protein coupled receptor 20

Gene and Protein Information

Gene ID2843
Uniprot Accession IDs Q99678 Q17R96
Ensembl ID ENSP00000366970
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp737712GPR20G protein-coupled receptor 209598VGNC:50314OMA, EggNOG
Mouse239530Gpr20G protein-coupled receptor 2010090MGI:2441803Inparanoid, OMA, EggNOG
Dog482061GPR20G protein-coupled receptor 209615VGNC:41425Inparanoid, OMA, EggNOG
Horse100069651GPR20G protein-coupled receptor 209796VGNC:18535Inparanoid, OMA, EggNOG
Cow515695GPR20G protein-coupled receptor 209913VGNC:29579Inparanoid, OMA, EggNOG
PigGPR20G protein-coupled receptor 20 [Source:HGNC Symbol;Acc:HGNC:4475]9823OMA, EggNOG
Opossum100032760GPR20G protein-coupled receptor 2013616Inparanoid, OMA, EggNOG
PlatypusGPR20G protein-coupled receptor 20 [Source:HGNC Symbol;Acc:HGNC:4475]9258OMA, EggNOG
Anole lizard100556704gpr20G protein-coupled receptor 2028377Inparanoid, OMA, EggNOG
Xenopusgpr20G protein-coupled receptor 20 [Source:Xenbase;Acc:XB-GENE-6040269]8364OMA, EggNOG
Zebrafish794428gpr20G protein-coupled receptor 207955ZDB-GENE-140106-136OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    G-protein coupled receptor 20

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.