🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GPR6

DescrizioneG-protein coupled receptor 6

Gene and Protein Information

Gene ID2830
Uniprot Accession IDs P46095 B4DHS9 J3KQR3 Q17RJ7 Q5SYL0
Ensembl ID ENSP00000406986
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp104001079GPR6G protein-coupled receptor 69598VGNC:11087OMA, EggNOG
Macaque697979GPR6G protein-coupled receptor 69544Inparanoid, OMA, EggNOG
Mouse140741Gpr6G protein-coupled receptor 610090MGI:2155249Inparanoid, OMA, EggNOG
Rat83683Gpr6G protein-coupled receptor 610116RGD:70939Inparanoid, OMA, EggNOG
Dog481959GPR6G protein-coupled receptor 69615VGNC:41439Inparanoid, OMA, EggNOG
Cow506661GPR6G protein-coupled receptor 69913VGNC:29592Inparanoid, OMA, EggNOG
Pig100511485GPR6G protein-coupled receptor 69823OMA, EggNOG
Opossum100022066GPR6G protein-coupled receptor 613616Inparanoid, OMA, EggNOG
Chicken101747493GPR6G protein-coupled receptor 69031CGNC:72019Inparanoid, OMA
Anole lizard100563711gpr6G protein-coupled receptor 628377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 6
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 6

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.