SLC5A4

DescrizioneSolute carrier family 5 member 4

Gene and Protein Information

Gene ID6527
Uniprot Accession IDs Q9NY91 O15279
Ensembl ID ENSP00000266086
Symbol SAAT1 SGLT3 SAAT1 SGLT3 DJ90G24.4
FamilyBelongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
Sequence
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp470189SLC5A4solute carrier family 5 member 49598VGNC:7805OMA, EggNOG
Macaque717137SLC5A4solute carrier family 5 member 49544Inparanoid, OMA, EggNOG
Mouse64452Slc5a4asolute carrier family 5, member 4a10090MGI:1927848Inparanoid, OMA
Rat294341Slc5a4solute carrier family 5 member 410116RGD:1306923Inparanoid, OMA
Dog100685907SLC5A4solute carrier family 5 member 49615VGNC:46447Inparanoid, OMA, EggNOG
Horse100058200SLC5A4solute carrier family 5 member 49796VGNC:52440Inparanoid, OMA
Cow527441SLC5A4solute carrier family 5 member 49913VGNC:34907Inparanoid, OMA, EggNOG
Pig397376SLC5A4solute carrier family 5 member 49823Inparanoid, OMA, EggNOG
Opossum100028976LOC100028976low affinity sodium-glucose cotransporter-like13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    carbohydrate transporter    /    Solute carrier family 5 member 4
protein    /    transporter    /    cation transporter    /    Solute carrier family 5 member 4
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC5 family of sodium-dependent glucose transporters    /    Hexose transporter family    /    Solute carrier family 5 member 4

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.