SHB

DescrizioneSH2 domain-containing adapter protein B

Gene and Protein Information

Gene ID6461
Uniprot Accession IDs Q15464 B9EGM0 D3DRQ5 Q504U5 Q5VUM8
Ensembl ID ENSP00000366936
Symbol bA3J10.2
Sequence
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp465107SHBSH2 domain containing adaptor protein B9598VGNC:10058OMA, EggNOG
Macaque716169SHBSH2 domain containing adaptor protein B9544OMA, EggNOG
Mouse230126Shbsrc homology 2 domain-containing transforming protein B10090MGI:98294Inparanoid, OMA, EggNOG
Rat362513ShbSH2 domain containing adaptor protein B10116RGD:1565350Inparanoid, OMA, EggNOG
Dog481619SHBSH2 domain containing adaptor protein B9615VGNC:46138Inparanoid, OMA, EggNOG
Cow538275SHBSH2 domain containing adaptor protein B9913VGNC:34588Inparanoid, OMA, EggNOG
Xenopus100489262shbSrc homology 2 domain containing adaptor protein B8364XB-GENE-6258291Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.