🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GPR88

DescrizioneProbable G-protein coupled receptor 88

Gene and Protein Information

Gene ID54112
Uniprot Accession IDs Q9GZN0 Q29S24 Q6VN48
Ensembl ID ENSP00000314223
Symbol STRG STRG COCPMR
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp735527GPR88G protein-coupled receptor 889598VGNC:11444OMA, EggNOG
Mouse64378Gpr88G-protein coupled receptor 8810090MGI:1927653Inparanoid, OMA, EggNOG
Rat64443Gpr88G-protein coupled receptor 8810116RGD:61921Inparanoid, OMA, EggNOG
Dog100686636GPR88G protein-coupled receptor 889615VGNC:54029Inparanoid, OMA, EggNOG
Cow781302GPR88G protein-coupled receptor 889913VGNC:29604Inparanoid, OMA, EggNOG
Opossum100029612GPR88G protein-coupled receptor 8813616Inparanoid, OMA, EggNOG
Chicken769393GPR88G protein-coupled receptor 889031CGNC:3908Inparanoid, OMA, EggNOG
Anole lizard103278641gpr88G protein-coupled receptor 8828377Inparanoid, OMA, EggNOG
Xenopusgpr88G protein-coupled receptor 88 [Source:Xenbase;Acc:XB-GENE-984668]8364OMA, EggNOG
Zebrafish100002845gpr88G protein-coupled receptor 887955ZDB-GENE-030131-8265Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Probable g-protein coupled receptor 88
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Probable g-protein coupled receptor 88

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.