GPX4

DescrizionePhospholipid hydroperoxide glutathione peroxidase

Gene and Protein Information

Gene ID2879
Uniprot Accession IDs P36969 O43381 Q6PJ59 Q9UPK2 PHGPx
Ensembl ID ENSP00000346103
Symbol MCSP SMDS GPx-4 PHGPx snGPx GSHPx-4 snPHGPx
FamilyBelongs to the glutathione peroxidase family.
Sequence
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp741876GPX4glutathione peroxidase 49598VGNC:2549Inparanoid, OMA, EggNOG
Mouse625249Gpx4glutathione peroxidase 410090MGI:104767Inparanoid, OMA, EggNOG
Rat29328Gpx4glutathione peroxidase 410116RGD:69226Inparanoid, OMA, EggNOG
Zebrafish352928gpx4aglutathione peroxidase 4a7955ZDB-GENE-030410-2Inparanoid, OMA
C. elegans187630gpx-2Glutathione peroxidase6239Inparanoid, OMA
Fruitfly38413PHGPxCG12013 gene product from transcript CG12013-RC7227FBgn0035438Inparanoid, EggNOG
S.cerevisiae852546GPX2glutathione peroxidase GPX24932S000000448OMA, EggNOG
S.cerevisiae853842GPX1glutathione peroxidase GPX14932S000001509Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    peroxidase    /    Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Peroxidase    /    Phospholipid hydroperoxide glutathione peroxidase, mitochondrial

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.