🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

SCAMP5

DescrizioneSecretory carrier-associated membrane protein 5

Gene and Protein Information

Gene ID192683
Uniprot Accession IDs Q8TAC9 B3KPJ7 B7Z762 D3DW71 Q8N3M4 Secretory carrier membrane protein 5
Ensembl ID ENSP00000355387
FamilyBelongs to the SCAMP family. SCAMP5 subfamily.
Sequence
MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp453752SCAMP5secretory carrier membrane protein 59598VGNC:1880OMA, EggNOG
Macaque710454SCAMP5secretory carrier membrane protein 59544Inparanoid, OMA, EggNOG
Mouse56807Scamp5secretory carrier membrane protein 510090MGI:1928948Inparanoid, OMA, EggNOG
Rat65171Scamp5secretory carrier membrane protein 510116RGD:68356Inparanoid, OMA
Dog478371SCAMP5secretory carrier membrane protein 59615VGNC:45893Inparanoid, OMA, EggNOG
Horse100061807SCAMP5secretory carrier membrane protein 59796VGNC:22712Inparanoid, OMA, EggNOG
Cow508510SCAMP5secretory carrier membrane protein 59913VGNC:34319Inparanoid, OMA, EggNOG
Pig100156508SCAMP5secretory carrier membrane protein 59823OMA, EggNOG
Opossum100030150SCAMP5secretory carrier membrane protein 513616Inparanoid, EggNOG
Chicken426413SCAMP5secretory carrier membrane protein 59031CGNC:10531Inparanoid, OMA, EggNOG
Anole lizard100554908scamp5secretory carrier membrane protein 528377Inparanoid, OMA, EggNOG
Xenopus779947scamp5secretory carrier membrane protein 58364XB-GENE-1006975Inparanoid, OMA, EggNOG
Zebrafish324467scamp5asecretory carrier membrane protein 5a7955ZDB-GENE-030131-3188Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.